NAD(P)H dehydrogenase subunit 4L ndhE NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient (By similarity). MMFEHVLFLSVYLFSIGIYGLITSRNMVRALICLELILNSINLNLVTFSDLFDSRQLKGDIFAIFVIALAAAEAAIGLSILSSIHRNRKSTRINQSNFLNN NADH-plastoquinone oxidoreductase subunit 4L 101 NU4LC_ORYSA PA171 NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic